PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00083490001
Common NameGSBRNA2T00083490001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 316aa    MW: 34467.8 Da    PI: 9.1887
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00083490001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-3953112362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s+
  GSBRNA2T00083490001  53 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSK 112
                          6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3536105IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3255110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46956110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQQGNTQQQD RVTSYQNPNF NLPSPPASQA GSSQARVNSM VERARIAKIP LPEAALKCPR  60
CDSTNTKFCY FNNYNLTQPR HFCKTCRRYW TRGGALRNVP VGGGFRRNKR SKSNGGGRSK  120
STVVVSADNN NTSSSLSCNP SYSNPTNFLS YGQAPGFTSN LPILPPFQSH GGYNSSNIGL  180
DFSGIQMSGM SSSGGMLDPW RMSSLQQSQQ FPFLSNTSEL DQSSNALYPL LDGNEGLRSK  240
PFMDMEQPRN VKAEENDQDL DKDGNGVNNL SRNFLGNINI NPSGNDEYTS WGGNSSINSS  300
WTGFTSNNST GHLSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013742337.10.0PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ9M2U11e-151DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A078JRU00.0A0A078JRU0_BRANA; BnaCnng62100D protein
STRINGBra014752.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.21e-104OBF-binding protein 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]